PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g49760.2.p
Common NameLOC100833579
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-PHD
Protein Properties Length: 696aa    MW: 76059.1 Da    PI: 4.6244
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g49760.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.5e-084534901552
                       HHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox  15 LeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       L+ + ek++yps+ ++e LA++lgLt +qV+ WF   R
  Bradi2g49760.2.p 453 LKVHLEKDPYPSRPTKESLAQELGLTFNQVSRWFSSAR 490
                       56666889**************************8777 PP

2PHD40.56.1e-1477132151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C++Cg+   +  ++++lCdg C + fH+kCl+++l  +++p g   wlC+ C++k
  Bradi2g49760.2.p  77 FCAICGSkhVTLRNDIILCDGaCVRGFHQKCLNPPLLAQDIPPGdeGWLCPACDCK 132
                       7******65555********66********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.46E-1367135IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.2E-1373132IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.92375132IPR019787Zinc finger, PHD-finger
PfamPF006284.3E-1177132IPR019787Zinc finger, PHD-finger
SMARTSM002492.2E-1077130IPR001965Zinc finger, PHD-type
CDDcd155041.58E-2477129No hitNo description
PROSITE patternPS01359078129IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007111.985436496IPR001356Homeobox domain
SMARTSM003891.2E-9438500IPR001356Homeobox domain
CDDcd000862.38E-10441494No hitNo description
SuperFamilySSF466891.37E-9442494IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-10452491IPR009057Homeodomain-like
PfamPF059205.9E-7459490IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MNYEQSLIQA YASEGWKGQS LEKIRPEKEL QRAKAEILRC KLRIREAFQN MDSLLSEGKL  60
EESLFDSEGE ISSEDIFCAI CGSKHVTLRN DIILCDGACV RGFHQKCLNP PLLAQDIPPG  120
DEGWLCPACD CKLDCIDVLN ELQGSTLSIH DSWEKVFPES ALLANGSNQI GSSDLPSDDS  180
EDNDYSPALA EGQMVDENKS SAEDEDEVSD SDDSDFMTSS DASELSMKKR SESKNKKTVD  240
DLGLPSEDSG DDDFDPAGPV SSEDQKAKTN SEESDFTSDS DDFCAEIAKS CGQDEVSPPS  300
SSDHADGIEI SAVDNQLGQE DNNRIIMETE LDQDVVLPVS SRRQVERLDY RRLYDEAYGK  360
EMSDSSDDEE WSGDSTSSNG NLDDSGTDSL AGSLQFAKIH SRRPQAGHQN NKHTPQTGRC  420
SVSTGQCSEV LYSNGSSSTS HKKHFGPIIN QKLKVHLEKD PYPSRPTKES LAQELGLTFN  480
QVSRWFSSAR HYSRIAGAKK EKHPENYTAE NDRTAADIQQ REPNGKVLEK QSVDRIDNVS  540
EGRVAAQNNI DEGKKGDAPF KQDISCEQTV VVIPTVVNQN CTTNSRKVGS PNSVPGENQH  600
SGTSRKAEHT PLKQNTGCKQ TVVVSPVDNQ NCTASTSNVG SPKSVPGGNK RRDASRNIGS  660
PRAGSAGNKI PGLEHVDEAR RKAILRELRK MKAGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754894.10.0PREDICTED: homeobox protein HOX1A-like isoform X1
SwissprotP466051e-174HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLI1HRI90.0I1HRI9_BRADI; Uncharacterized protein
STRINGBRADI2G49760.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Representative plantOGRP18301539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-70Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain